GUCY1A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GUCY1A2 antibody is: synthetic peptide directed towards the N-terminal region of Human GUCY1A2. Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	guanylate cyclase 1, soluble, alpha 2
Database Link	NP_001243353 Entrez Gene 2977 Human UniProt ID P33402
Background	Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms	GC-SA2; GUC1A2
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%; Dog: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Gap junction, Long-term depression, Purine metabolism, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.