GLB1L3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GLB1L3 antibody is: synthetic peptide directed towards the C-terminal region of Human GLB1L3. Synthetic peptide located within the following region: KHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	galactosidase beta 1 like 3
Database Link	NP_001073876 Entrez Gene 112937 Human UniProt ID Q8NCI6
Background	The function of this protein remains unknown.
Synonyms	FLJ90231
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 91%; Zebrafish: 91%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.