LAS1L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LAS1L antibody is: synthetic peptide directed towards the middle region of Human LAS1L. Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	LAS1-like, ribosome biogenesis factor
Database Link	NP_112483 Entrez Gene 81887 Human UniProt ID Q9Y4W2
Background	The function of LAS1L has not been determined.
Synonyms	dJ475B7.2; Las1-like; WTS
Note	Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.