HMGCL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	3-hydroxymethyl-3-methylglutaryl-CoA lyase
Database Link	NP_000182 Entrez Gene 79238 Rat UniProt ID P35914
Background	Hmgcl is an enzyme of the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle.
Synonyms	HL
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.