IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	interleukin 13 receptor subunit alpha 2
Database Link	NP_000631 Entrez Gene 3598 Human UniProt ID Q14627
Background	IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	CD213A2; CT19; IL-13R; IL13BP
Note	Immunogen Sequence Homology: Human: 100%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Jak-STAT signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.