FAM13C1 (FAM13C) Rabbit Polyclonal Antibody

CAT#: TA336196

Rabbit Polyclonal Anti-FAM13C1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human family with sequence similarity 13, member C (FAM13C), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of family with sequence similarity 13, member C (FAM13C), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human family with sequence similarity 13, member C (FAM13C), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of family with sequence similarity 13, member C (FAM13C), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-FAM13C1 Antibody: synthetic peptide directed towards the N terminal of human FAM13C1. Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name family with sequence similarity 13 member C
Background FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.
Synonyms FAM13C1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Rat: 92%; Pig: 85%; Guinea pig: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...