NRG3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NRG3 Antibody: synthetic peptide directed towards the middle region of human NRG3. Synthetic peptide located within the following region: TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	neuregulin 3
Database Link	NP_001010848 Entrez Gene 10718 Human UniProt ID P56975
Background	Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.
Synonyms	HRG3; pro-NRG3
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ErbB signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.