LDLRAD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LDLRAD1 Antibody: synthetic peptide directed towards the middle region of human LDLRAD1. Synthetic peptide located within the following region: DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	low density lipoprotein receptor class A domain containing 1
Database Link	NP_001010978 Entrez Gene 388633 Human UniProt ID Q5T700
Background	The function of this protein remains unknown.
Synonyms	low density lipoprotein receptor A domain containing 1; low density lipoprotein receptor class A domain containing 1; OTTHUMP00000010102
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Mouse: 91%; Bovine: 86%; Dog: 85%; Rat: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.