MPG Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the middle region of human MPG. Synthetic peptide located within the following region: QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	N-methylpurine DNA glycosylase
Database Link	NP_001015054 Entrez Gene 4350 Human UniProt ID P29372
Background	MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
Synonyms	AAG; ADPG; anpg; APNG; CRA36.1; MDG; Mid1; PIG11; PIG16
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 79%; Rat: 79%; Horse: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Base excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.