ANO6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ano6 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	106 kDa
Gene Name	anoctamin 6
Database Link	NP_001020527 Entrez Gene 105722 Mouse UniProt ID Q4KMQ2
Background	Ano6 may act as a calcium-activated chloride channel By similarity. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system.
Synonyms	BDPLT7; SCTS; TMEM16F
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.