SAR1B Rabbit Polyclonal Antibody
CAT#: TA336024
Rabbit Polyclonal Anti-SAR1B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SAR1B Antibody: synthetic peptide directed towards the middle region of human SAR1B. Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | secretion associated Ras related GTPase 1B |
Database Link | |
Background | SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex. |
Synonyms | ANDD; CMRD; GTBPB; SARA2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%; Yeast: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |