ZDHHC19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZDHHC19 Antibody: synthetic peptide directed towards the N terminal of human ZDHHC19. Synthetic peptide located within the following region: TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	zinc finger DHHC-type containing 19
Database Link	NP_001034706 Entrez Gene 131540 Human UniProt ID Q8WVZ1
Background	ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
Synonyms	DHHC19
Note	Immunogen Sequence Homology: Human: 100%; Pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.