OLAH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-OLAH Antibody: synthetic peptide directed towards the N terminal of human OLAH. Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	oleoyl-ACP hydrolase
Database Link	NP_001034791 Entrez Gene 55301 Human UniProt ID Q9NV23
Background	OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f
Synonyms	AURA1; SAST; THEDC1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 83%; Rabbit: 83%; Pig: 79%; Mouse: 77%
Reference Data
Protein Pathways	Fatty acid biosynthesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.