SPOCK3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SPOCK3 Antibody: synthetic peptide directed towards the middle region of human SPOCK3. Synthetic peptide located within the following region: CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3
Database Link	NP_001035249 Entrez Gene 50859 Human UniProt ID Q9BQ16
Background	Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan familyProteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family. [supplied by OMIM]
Synonyms	HSAJ1454; TES-3; TICN3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.