ABHD12 Rabbit Polyclonal Antibody
CAT#: TA335957
Rabbit Polyclonal Anti-ABHD12 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ABHD12 Antibody: synthetic peptide directed towards the middle region of human ABHD12. Synthetic peptide located within the following region: CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | abhydrolase domain containing 12 |
Database Link | |
Background | ABHD12 has 2-arachidonoylglycerol hydrolase activity.ABHD12 may be a regulator of endocannabinoid signaling pathways. |
Synonyms | ABHD12A; BEM46L2; C20orf22; dJ965G21.2; PHARC |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%; Yeast: 80% |
Reference Data | |
Protein Families | Protease, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |