TMEM91 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMEM91 Antibody: synthetic peptide directed towards the N terminal of human TMEM91. Synthetic peptide located within the following region: MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	transmembrane protein 91
Database Link	NP_001036060 Entrez Gene 641649 Human UniProt ID Q6ZNR0
Background	The function remains unknown.
Synonyms	DSPC3; IFITMD6
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.