TBC1D14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TBC1D14 Antibody: synthetic peptide directed towards the N terminal of human TBC1D14. Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	TBC1 domain family member 14
Database Link	NP_001106832 Entrez Gene 57533 Human UniProt ID Q9P2M4
Background	TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).
Synonyms	FLJ32400; KIAA1322
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.