Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SP4 Antibody: synthetic peptide directed towards the middle region of human SP4. Synthetic peptide located within the following region: GGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	Sp4 transcription factor
Database Link	NP_003103 Entrez Gene 6671 Human UniProt ID Q02446
Background	SP4 belongs to the Sp1 C2H2-type zinc-finger protein family. It contains 3 C2H2-type zinc fingers. SP4 binds to GT and GC boxes promoters elements.It is a probable transcriptional activator.
Synonyms	HF1B; SPR-1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.