LPP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LPP Antibody: synthetic peptide directed towards the N terminal of human LPP. Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	LIM domain containing preferred translocation partner in lipoma
Database Link	NP_005569 Entrez Gene 4026 Human UniProt ID Q93052
Background	LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.
Synonyms	DKFZp779O0231; FLJ30652; FLJ41512
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 92%; Horse: 92%; Rabbit: 92%; Bovine: 81%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.