CBX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	chromobox 1
Database Link	NP_006798 Entrez Gene 10951 Human UniProt ID P83916
Background	CBX1 is the component of heterochromatin. CBX1 recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. CBX1 interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the in
Synonyms	CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.