ATG4B Rabbit Polyclonal Antibody

CAT#: TA335641

Rabbit Polyclonal Anti-ATG4B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name autophagy related 4B cysteine peptidase
Background Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. APG4B encodes a member of the autophagin protein family and is also designated as a member of the C-54 family of cysteine proteases.
Synonyms APG4B; AUTL1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 85%
Reference Data
Protein Families Protease
Protein Pathways Regulation of autophagy
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...