WBP5 (TCEAL9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-WBP5 Antibody is: synthetic peptide directed towards the N-terminal region of Human WBP5. Synthetic peptide located within the following region: QKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13 kDa
Gene Name	transcription elongation factor A like 9
Database Link	NP_057387 Entrez Gene 51186 Human UniProt ID Q9UHQ7
Background	The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform.
Synonyms	WBP5; WEX6
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 86%; Yeast: 85%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.