United States
Germany
Japan
United Kingdom
China
WBP5 (TCEAL9) (NM_016303) Human Recombinant Protein
CAT＃: TP312064
Recombinant protein of human WW domain binding protein 5 (WBP5), transcript variant 1, 20 µg
View other "WBP5" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212064 protein sequence
Red=Cloning site Green=Tags(s) MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057387 |
| Locus ID | 51186 |
| UniProt ID | Q9UHQ7 |
| Refseq Size | 1102 |
| Cytogenetics | Xq22.2 |
| Refseq ORF | 312 |
| Synonyms | WBP5; WEX6 |
| Summary | The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414074 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423688 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423689 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423690 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414074 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 1 |
CNY 3,080.00 |
|
| LY423688 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 2 |
CNY 3,080.00 |
|
| LY423689 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 3 |
CNY 3,080.00 |
|
| LY423690 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 4 |
CNY 3,080.00 |
|
| PH312064 | WBP5 MS Standard C13 and N15-labeled recombinant protein (NP_057387) |
CNY 19,520.00 |
