ISYNA1 Rabbit Polyclonal Antibody

CAT#: TA335561

Rabbit Polyclonal Anti-ISYNA1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of inositol-3-phosphate synthase 1 (ISYNA1), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human inositol-3-phosphate synthase 1 (ISYNA1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human inositol-3-phosphate synthase 1 (ISYNA1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 61 kDa
Gene Name inositol-3-phosphate synthase 1
Background Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]). [supplied by OMIM]
Synonyms INO1; INOS; IPS; IPS-1; IPS 1
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Yeast: 92%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...