ERGIC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ERGIC2 Antibody: synthetic peptide directed towards the middle region of human ERGIC2. Synthetic peptide located within the following region: TVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	ERGIC and golgi 2
Database Link	NP_057654 Entrez Gene 51290 Human UniProt ID Q96RQ1
Background	ERGIC2 belongs to the ERGIC family.It possible play role in transport between endoplasmic reticulum and Golgi.
Synonyms	cd002; CDA14; Erv41; PTX1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.