EFHC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EFHC1 Antibody: synthetic peptide directed towards the N terminal of human EFHC1. Synthetic peptide located within the following region: SYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	EF-hand domain containing 1
Database Link	NP_060570 Entrez Gene 114327 Human UniProt ID Q5JVL4
Background	This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.
Synonyms	dJ304B14.2; EJM1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.