VNN3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-VNN3 Antibody: synthetic peptide directed towards the N terminal of human VNN3. Synthetic peptide located within the following region: VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	vanin 3
Database Link	NP_060869 Entrez Gene 55350 Human UniProt ID Q9NY84
Background	This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs.
Synonyms	HSA238982; MGC124285; MGC171203; OTTMUSP00000022908; PAGEL-beta; PAGEL-eta; PAGEL-zeta; vanin 3; vascular non-inflammatory molecule 3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Sheep: 91%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.