PPP2R2D Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ppp2r2a Antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a. Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	protein phosphatase 2 regulatory subunit Bdelta
Database Link	NP_060931 Entrez Gene 55844 Human UniProt ID Q66LE6
Background	Human homolog forms a complex with cyclin G2 that may inhibit cell cycle progression.
Synonyms	MDS026
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Phosphatase
Protein Pathways	Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.