ANKRD7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ANKRD7 Antibody: synthetic peptide directed towards the middle region of human ANKRD7. Synthetic peptide located within the following region: EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	ankyrin repeat domain 7
Database Link	NP_062618 Entrez Gene 56311 Human UniProt ID Q92527
Background	ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.
Synonyms	TSA806
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 91%; Rat: 79%; Mouse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.