DUS3L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DUS3L Antibody is: synthetic peptide directed towards the N-terminal region of Human DUS3L. Synthetic peptide located within the following region: GQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	dihydrouridine synthase 3 like
Database Link	NP_064560 Entrez Gene 56931 Human UniProt ID Q96G46
Background	DUS3L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
Synonyms	DUS3
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.