RSK3 (RPS6KA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RPS6KA2 Antibody: synthetic peptide directed towards the middle region of human RPS6KA2. Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	ribosomal protein S6 kinase A2
Database Link	NP_066958 Entrez Gene 6196 Human UniProt ID Q15349
Background	RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms	HU-2; MAPKAPK1C; p90-RSK3; p90RSK2; pp90RSK3; RSK; RSK3; S6K-alpha; S6K-alpha2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 86%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Long-term potentiation, MAPK signaling pathway, mTOR signaling pathway, Neurotrophin signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.