zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF655 Antibody: synthetic peptide directed towards the N terminal of human ZNF655. Synthetic peptide located within the following region: QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	zinc finger protein 655
Database Link	NP_076966 Entrez Gene 79027 Human UniProt ID Q8N720
Background	ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions.
Synonyms	VIK; VIK-1
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 91%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.