FAM130A1 (CSRNP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CSRNP2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CSRNP2. Synthetic peptide located within the following region: PAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	cysteine and serine rich nuclear protein 2
Database Link	NP_110436 Entrez Gene 81566 Human UniProt ID Q9H175
Background	The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene.
Synonyms	C12orf2; C12orf22; FAM130A1; PPP1R72; TAIP-12
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rat: 86%; Dog: 85%; Bovine: 85%; Rabbit: 79%; Sheep: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.