FHL2 Rabbit Polyclonal Antibody

CAT#: TA335334

Rabbit Polyclonal Anti-FHL2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 2
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 4, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human four and a half LIM domains 2 (FHL2), transcript variant 2, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-FHL2 Antibody: synthetic peptide directed towards the C terminal of human FHL2. Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 32 kDa
Gene Name four and a half LIM domains 2
Background FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.
Synonyms AAG11; DRAL; FHL-2; SLIM-3; SLIM3
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 87%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...