PAX6 Rabbit Polyclonal Antibody

CAT#: TA335202

Rabbit Polyclonal Anti-PAX6 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Transient overexpression lysate of paired box 6 (PAX6), transcript variant 1
    • 100 ug

CN¥ 3,080.00


Transient overexpression lysate of paired box 6 (PAX6), transcript variant 2
    • 100 ug

CN¥ 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 48 kDa
Gene Name paired box 6
Background This gene encodes paired box gene 6, one of many human homologs of the Drosophila melanogaster gene prd. In addition to the hallmark feature of this gene family, a conserved paired box domain, the encoded protein also contains a homeo box domain. Both domains are known to bind DNA and function as regulators of gene transcription. This gene is expressed in the developing nervous system, and in developing eyes. Mutations in this gene are known to cause ocular disorders such as aniridia and Peter's anomaly. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Synonyms AN; AN2; D11S812E; FVH1; MGDA; WAGR
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...