BLVRB Rabbit Polyclonal Antibody
CAT#: TA335155
Rabbit polyclonal Anti-BLVRB Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 4,628.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BLVRB antibody: synthetic peptide directed towards the middle region of human BLVRB. Synthetic peptide located within the following region: GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | biliverdin reductase B |
Database Link | |
Background | BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin. |
Synonyms | BVRB; FLR; HEL-S-10; SDR43U1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 92%; Horse: 86% |
Reference Data | |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |