Protein S (PROS1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	protein S (alpha)
Database Link	NP_000304 Entrez Gene 19128 MouseEntrez Gene 5627 Human UniProt ID P07225
Background	PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
Synonyms	PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Complement and coagulation cascades

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.