HSPA6 Rabbit Polyclonal Antibody

CAT#: TA335045

Rabbit Polyclonal Anti-HSPA6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of heat shock 70kDa protein 6 (HSP70B') (HSPA6)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human heat shock 70kDa protein 6 (HSP70B') (HSPA6), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human heat shock 70kDa protein 6 (HSP70B') (HSPA6), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 71 kDa
Gene Name heat shock protein family A (Hsp70) member 6
Background In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Synonyms heat shock 70kDa protein 6 (HSP70B'); heat shock 70kD protein 6 (HSP70B')
Note Immunogen Sequence Homology: Human: 100%; Pig: 79%
Reference Data
Protein Pathways Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...