FGR Rabbit Polyclonal Antibody

CAT#: TA334987

Rabbit Polyclonal Anti-FGR Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 1
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 3
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FGR antibody: synthetic peptide directed towards the middle region of human FGR. Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 59 kDa
Gene Name FGR proto-oncogene, Src family tyrosine kinase
Background This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Synonyms c-fgr; c-src2; p55-Fgr; p55c-fgr; p58-Fgr; p58c-fgr; SRC2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Bovine: 86%; Pig: 83%; Zebrafish: 83%; Guinea pig: 83%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Chemokine signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...