ANXA2R Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	annexin A2 receptor
Database Link	NP_001014301 Entrez Gene 389289 Human UniProt ID Q3ZCQ2
Background	ANXA2R may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Synonyms	AX2R; AXIIR; C5orf39
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.