C8orf82 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C8orf82 antibody is synthetic peptide directed towards the N-terminal region of Human C8orf82. Synthetic peptide located within the following region: TLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	chromosome 8 open reading frame 82
Database Link	NP_001001795 Entrez Gene 414919 Human UniProt ID Q6P1X6
Background	The function of this protein remains unknown.
Synonyms	MGC70857
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%; Dog: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.