RCOR3 Rabbit Polyclonal Antibody
CAT#: TA334759
Rabbit Polyclonal Anti-RCOR3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
CNY 4,840.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RCOR3 antibody: synthetic peptide directed towards the N terminal of human RCOR3. Synthetic peptide located within the following region: MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | REST corepressor 3 |
Database Link | |
Background | RCOR3 is a REST corepressor 3 protein located on chromosome 1. |
Synonyms | RP11-318L16.1 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |