CYBA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	cytochrome b-245 alpha chain
Database Link	NP_000092 Entrez Gene 1535 Human UniProt ID P13498
Background	Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells. [provided by RefSeq, Jul 2008]
Synonyms	p22-PHOX
Note	Immunogen Sequence Homology: Human: 100%; Sheep: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Dog: 79%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Leukocyte transendothelial migration

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.