SLC35E2A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC35E2 antibody: synthetic peptide directed towards the middle region of human SLC35E2. Synthetic peptide located within the following region: AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	solute carrier family 35 member E2
Database Link	NP_878258 Entrez Gene 9906 Human UniProt ID P0CK97
Background	SLC35E2 is a putative transporter.
Synonyms	DKFZp686M0869; FLJ34996; FLJ44537; KIAA0447; MGC104754; MGC117254; MGC126715; MGC138494
Note	Immunogen Sequence Homology: Human: 100%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.