SLC6A15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Slc6a15 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	solute carrier family 6 member 15
Database Link	NP_877499 Entrez Gene 103098 Mouse UniProt ID Q9H2J7
Background	Slc6a15 functions as a sodium-dependent neutral amino acid transporter. It exhibits preference for methionine and for the branched-chain amino acids, particulary leucine, valine and isoleucine. It mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. Slc6a15 may have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, Slc6a15 does not appear to be chloride-dependent.
Synonyms	hv7-3; NTT73; SBAT1; V7-3
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.