VASH1 Rabbit Polyclonal Antibody

CAT#: TA334559

Rabbit Polyclonal Anti-VASH1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of vasohibin 1 (VASH1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human vasohibin 1 (VASH1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human vasohibin 1 (VASH1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the N terminal of human VASH1. Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 41 kDa
Gene Name vasohibin 1
Background VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms KIAA1036
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 79%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...