PI 3 Kinase regulatory subunit 4 (PIK3R4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	153 kDa
Gene Name	phosphoinositide-3-kinase regulatory subunit 4
Database Link	NP_055417 Entrez Gene 30849 Human UniProt ID Q99570
Background	The protein can regulate subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.
Synonyms	p150; VPS15
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Regulation of autophagy

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.