RTDR1 (RSPH14) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the middle region of human RTDR1. Synthetic peptide located within the following region: IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	radial spoke head 14 homolog
Database Link	NP_055248 Entrez Gene 27156 Human UniProt ID Q9UHP6
Background	The specific function of the protein remains unknown.This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
Synonyms	RTDR1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%; Guinea pig: 79%; Horse: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.