RPA4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the C terminal of human RPA4. Synthetic peptide located within the following region: HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	replication protein A4
Database Link	NP_037479 Entrez Gene 29935 Human UniProt ID Q13156
Background	Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex.Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1448 BC069824.1 1-1448
Synonyms	HSU24186
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.