GLUD2 Rabbit Polyclonal Antibody
CAT#: TA334427
Rabbit Polyclonal Anti-GLUD2 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | glutamate dehydrogenase 2 |
Database Link | |
Background | Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. |
Synonyms | GDH2; GLUDP1 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Mouse: 85%; Sheep: 77%; Bovine: 77% |
Reference Data | |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |